PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0144s0046.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 346aa    MW: 37912.2 Da    PI: 7.9323
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0144s0046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32221274255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0144s0046.1.p 221 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 274
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15218275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-29219275IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-24221274IPR006447Myb domain, plants
PfamPF002494.6E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MPINSQSDTA MVVPDLDLHI SLLPNTVVAS SSSLSTSSIY CREEPDTELS LLPSSSETEN  60
LWRQQQQQQK TSSSSTLGLD EAAKNPNRSL HFCPSFPGGR QVTANTYQQY VPDEGWNSKP  120
IKGIPIYNQS CSSSSSASAL CSSNPSFGGL LRLNGISMEA IRQPQQQFQY LRSCSSNQQY  180
LGIVGPGGHS TNGIAPEVNG GVLRSRFMLP KIQNRRNVRA PRMRWTSSLH ARFVHAVELL  240
GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKSTDR PAASSDGSGD EAFSHMEESR  300
GSTADKREIA KELLSLNERE AVDGSYELNY SARSNIRSDS NARYS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376702.12e-61hypothetical protein POPTR_0012s03900g
RefseqXP_011000707.18e-61PREDICTED: transcription repressor KAN1-like
SwissprotQ93WJ97e-51KAN1_ARATH; Transcription repressor KAN1
TrEMBLU5FWI53e-61U5FWI5_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03900.18e-61(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.17e-50G2-like family protein